General Information

  • ID:  hor006093
  • Uniprot ID:  O77559
  • Protein name:  Proadrenomedullin N-20 terminal peptide
  • Gene name:  ADM
  • Organism:  Canis lupus familiaris (Dog) (Canis familiaris)
  • Family:  Adrenomedullin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Canis lupus (species), Canis (genus), Canidae (family), Caniformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0031700 adrenomedullin receptor binding
  • GO BP:  GO:0003073 regulation of systemic arterial blood pressure; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0010460 positive regulation of heart rate; GO:1990410 adrenomedullin receptor signaling pathway
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  ARLDVASEFRKKWNKWAVSR
  • Length:  20
  • Propeptide:  MKLVPVALLYLGSLAFLGADTARLDVASEFRKKWNKWAVSRGKRELRVSSSYPTGLAEVKAGPAQTLIRTQDVKGASRNPQTSGPDAARIRVKRYRQSMNNFQGPRSFGCRFGTCTVQKLAHQIYQFTDNDKDGVAPRSKISPQGYGRRRRRSLPEPGLRRTLLFPEPRPGGAPAPRAHQVLANLLKM
  • Signal peptide:  MKLVPVALLYLGSLAFLGADT
  • Modification:  T20 Arginine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  AM and PAMP are potent hypotensive and vasodilatator agents.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O77559-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006093_AF2.pdbhor006093_ESM.pdb

Physical Information

Mass: 278690 Formula: C111H175N35O28
Absent amino acids: CGHIMPQTY Common amino acids: AKR
pI: 11.65 Basic residues: 6
Polar residues: 3 Hydrophobic residues: 9
Hydrophobicity: -93.5 Boman Index: -6431
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 63.5
Instability Index: 3925.5 Extinction Coefficient cystines: 11000
Absorbance 280nm: 578.95

Literature

  • PubMed ID:  9788655
  • Title:  cDNA cloning of canine adrenomedullin and its gene expression in the heart and blood vessels in endotoxin shock.